PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_12314_iso_6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 322aa    MW: 36387.6 Da    PI: 7.6285
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_12314_iso_6genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.13.5e-171461148
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                          +g W++eEde+l++ ++++G g+W+++++  g+ R++k c++rw +yl
  cra_locus_12314_iso_6_len_1486_ver_3 14 KGLWSPEEDEKLIKHITKYGHGCWSSVPKLAGLQRCGKRCRLRWINYL 61
                                          678*******************************************97 PP

2Myb_DNA-binding46.96.4e-1567109145
                                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
                       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                           rg +++eE+ l++++++ lG++ W+ Ia++++ gRt++++k+ w+
  cra_locus_12314_iso_6_len_1486_ver_3  67 RGTFSPEEESLIIELHAVLGNR-WSQIAAKLP-GRTDNEIKNLWN 109
                                           899*******************.*********.*********998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-27664IPR009057Homeodomain-like
PROSITE profilePS5129425.07965IPR017930Myb domain
SuperFamilySSF466892.02E-2912108IPR009057Homeodomain-like
SMARTSM007171.1E-121363IPR001005SANT/Myb domain
PfamPF002496.1E-151461IPR001005SANT/Myb domain
CDDcd001673.09E-111761No hitNo description
Gene3DG3DSA:1.10.10.603.0E-2565116IPR009057Homeodomain-like
PROSITE profilePS5129419.84766116IPR017930Myb domain
SMARTSM007172.4E-1366114IPR001005SANT/Myb domain
PfamPF002491.1E-1367109IPR001005SANT/Myb domain
CDDcd001671.23E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLIKHIT KYGHGCWSSV PKLAGLQRCG KRCRLRWINY  60
LRPDLKRGTF SPEEESLIIE LHAVLGNRWS QIAAKLPGRT DNEIKNLWNS SIKKKLRQRG  120
IDPNTHQPLS EIDQNEEKTA KNHDHHKVSE VSNSELNFVE TTENSHDHQI ISEKPIKQQQ  180
PTSSSSIVPN FPLLENTTVP PPTHEFFLNR FLASHDQTSN STSKPQDFQD YFNFQQLNYG  240
TNIGLSMNLN PNIATATATA AATSFFSPTS RSSTEMVSIG LPGSETIDQL QGNCSFFDNN  300
GGFSWGKTTE KDAAGETEDI KW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-30121165108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016450602.11e-131PREDICTED: transcription factor MYB86-like
TrEMBLM1BAE01e-115M1BAE0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000407741e-115(Solanum tuberosum)